PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00150639001
Common NameGSBRNA2T00150639001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 420aa    MW: 46348.7 Da    PI: 5.8462
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00150639001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box18.93.2e-06739335
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHk 35
                            C+ ++e  + lfC+ +   lC  C  + H 
  GSBRNA2T00150639001  7 RVPCDFCNERAAVLFCRADAAKLCLPCDRHVHT 39
                         678******99******************9994 PP

2zf-B_box22.32.8e-075081334
             zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeH 34
                          ++C+++++++++  C++++  lC++C    H
  GSBRNA2T00150639001 50 SQICDNCGSEPVSVRCFTDSLVLCQECDWDVH 81
                         689************************98778 PP

3CCT66.95.5e-23371414144
                  CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                          R++a++RYkeKrktR+++K+irYesRKa+A++R RvKGrFvk++
  GSBRNA2T00150639001 371 RDNAMQRYKEKRKTRRYDKTIRYESRKARADTRLRVKGRFVKAT 414
                          899***************************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.513552IPR000315B-box-type zinc finger
SMARTSM003364.0E-12552IPR000315B-box-type zinc finger
CDDcd000211.62E-8852No hitNo description
PROSITE profilePS501198.6884895IPR000315B-box-type zinc finger
CDDcd000212.03E-85281No hitNo description
SMARTSM003360.515395IPR000315B-box-type zinc finger
PfamPF062032.2E-17371413IPR010402CCT domain
PROSITE profilePS5101715.11371413IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MSSSSERVPC DFCNERAAVL FCRADAAKLC LPCDRHVHTA NLLSKKHVRS QICDNCGSEP  60
VSVRCFTDSL VLCQECDWDV HGSCSVSDAH VRSAIEGFTG CPSALELGAL WGIDLEGRKE  120
EEKQVPVTME SFGMELDSWI SGSDVLQELV VPVPKKGGSS CGRYKQMLGK QLEELLRSGG  180
GGGVDDGECD GEAGEEGNMV PEMQERLGWR RDEEEISGGG EVNQQPQTTS FTALLWNAAN  240
TSDGQRQSTQ IWDFKLGQSR EPEDSSRMKA AYVTKDAASF KINSFVEVKK NDTCSTKAKG  300
VKEIFQDDYN QSTSGQVLTC ESNNLPITFG SEKGSNSSSE LNFTENIGGT SCKSTRRVAT  360
KADLERLAQN RDNAMQRYKE KRKTRRYDKT IRYESRKARA DTRLRVKGRF VKATEAPYP*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.159100.0seed
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00150639001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1891940.0AC189194.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB003O07, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009109761.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 15
SwissprotQ9C7E80.0COL15_ARATH; Zinc finger protein CONSTANS-LIKE 15
TrEMBLA0A078DNN90.0A0A078DNN9_BRANA; BnaA08g18650D protein
STRINGBra010908.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38712647
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G28050.10.0B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]